(data stored in ACNUC10821 zone)

EMBL: AE017262.PE157

AE017262.PE157       Location/Qualifiers
FT   CDS             155016..155459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0160"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02947"
FT                   /protein_id="AAT02947.1"
FT                   /translation="MEEQEIIGKIESLPNNFSENDSIYISQENIKNLVLFSKENQTVLE
FT                   LLITPFLICVNSGLKYELHYYEISTEISKNDTEIIGFPFGNKLPKEITDNISPKLFVRR
FT                   EDYSAFENFLSQYFNAMKSMEFADDKQAIGMIEHGATLFYEVL"
     MEEQEIIGKI ESLPNNFSEN DSIYISQENI KNLVLFSKEN QTVLELLITP FLICVNSGLK        60
     YELHYYEIST EISKNDTEII GFPFGNKLPK EITDNISPKL FVRREDYSAF ENFLSQYFNA       120
     MKSMEFADDK QAIGMIEHGA TLFYEVL                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page