(data stored in ACNUC10821 zone)

EMBL: AE017262.PE161

AE017262.PE161       Location/Qualifiers
FT   CDS             156716..156865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0164"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02951"
FT                   /protein_id="AAT02951.1"
FT                   /translation="MQDISLEKHGDNEEFIDSFLNLSIMTISVVCKDIIVEELDQKNIS
FT                   FLER"
     MQDISLEKHG DNEEFIDSFL NLSIMTISVV CKDIIVEELD QKNISFLER                    49
//

If you have problems or comments...

PBIL Back to PBIL home page