(data stored in ACNUC10821 zone)

EMBL: AE017262.PE162

AE017262.PE162       Location/Qualifiers
FT   CDS             157006..157377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0165"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02952"
FT                   /protein_id="AAT02952.1"
FT                   /translation="MFHERIKNSDLINEKQYPVKVVFDEISDEEFISIINSVSKGEGFG
FT                   VESGTCLFPGDLDEYDIAQGEGFGGVEFGLYSGSEIVIDYKQFYYYLNIICNRYVESYP
FT                   AKKLLVDNELKKYQELYSI"
     MFHERIKNSD LINEKQYPVK VVFDEISDEE FISIINSVSK GEGFGVESGT CLFPGDLDEY        60
     DIAQGEGFGG VEFGLYSGSE IVIDYKQFYY YLNIICNRYV ESYPAKKLLV DNELKKYQEL       120
     YSI                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page