(data stored in ACNUC10821 zone)

EMBL: AE017262.PE175

AE017262.PE175       Location/Qualifiers
FT   CDS             172696..173529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0204; match
FT                   to protein family HMM PF04468"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02965"
FT                   /protein_id="AAT02965.1"
FT                   /translation="MLKIVGVRFKDVGKIYYFSPGELEITENQGVIVENAQGIEFGKTV
FT                   IEPRYVDEEDVVLPLKKVLRIATEADYKCVAENGDSCQKAFLLCDEKIRERELEMSLVD
FT                   VDYTFDRNKIIFYFTAEGRVDFRELVKDLASVFRTRIELRQIGVRDEAKLLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYEQAKREMPDV
FT                   GVKVKTPEGIEARVSGINLLSRILQVSLPEEETVIEYELDELRPYNEFLKQPAKS"
     MLKIVGVRFK DVGKIYYFSP GELEITENQG VIVENAQGIE FGKTVIEPRY VDEEDVVLPL        60
     KKVLRIATEA DYKCVAENGD SCQKAFLLCD EKIRERELEM SLVDVDYTFD RNKIIFYFTA       120
     EGRVDFRELV KDLASVFRTR IELRQIGVRD EAKLLGGIGP CGRMLCCSTF LGDFEPVSIK       180
     MAKDQNLSLN PTKISGLCGR LMCCLKYEND EYEQAKREMP DVGVKVKTPE GIEARVSGIN       240
     LLSRILQVSL PEEETVIEYE LDELRPYNEF LKQPAKS                                277
//

If you have problems or comments...

PBIL Back to PBIL home page