(data stored in ACNUC10821 zone)

EMBL: AE017262.PE176

AE017262.PE176       Location/Qualifiers
FT   CDS             173540..173929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:10172658; match to
FT                   protein family HMM PF06156"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02966"
FT                   /db_xref="GOA:Q724P5"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724P5"
FT                   /protein_id="AAT02966.1"
FT                   /translation="MDKKAIFDSVSNMEEQIGELYQQLGDLKTNLGEMLEENNRLNLEN
FT                   EHLRRRLSLTDEATPEPKAEIEAEHGVMAPNRKEAMQQMIELGEGYDNLVQLYKEGFHV
FT                   CNVHFGSPRGNDEDCLFCLSLLNKK"
     MDKKAIFDSV SNMEEQIGEL YQQLGDLKTN LGEMLEENNR LNLENEHLRR RLSLTDEATP        60
     EPKAEIEAEH GVMAPNRKEA MQQMIELGEG YDNLVQLYKE GFHVCNVHFG SPRGNDEDCL       120
     FCLSLLNKK                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page