(data stored in ACNUC10821 zone)

EMBL: AE017262.PE177

AE017262.PE177       Location/Qualifiers
FT   CDS             173978..174739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P37543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02967"
FT                   /protein_id="AAT02967.1"
FT                   /translation="MNHLEKLELIGDERLDYLLAENLRIIQSPSVFSFSIDAVLLAKFS
FT                   YLPIRKGKIIDLCSGNGIIPLLLSTRTKAKIVGVEIQERLADMAKRSVAYNQLEDQIEI
FT                   IEYDLKKITDLIPKERADIVTCNPPYFATPDTSLKNTNEHFRIARHEVMCTLEDTIRVA
FT                   ASLLKQGGKANFVHRPERLLDIIDIMRKYRLEPKRIQFVHPRSDREANTVLVEGIKDGK
FT                   PGVKYVPPVIVYDELGEYTPVIKEILYGESE"
     MNHLEKLELI GDERLDYLLA ENLRIIQSPS VFSFSIDAVL LAKFSYLPIR KGKIIDLCSG        60
     NGIIPLLLST RTKAKIVGVE IQERLADMAK RSVAYNQLED QIEIIEYDLK KITDLIPKER       120
     ADIVTCNPPY FATPDTSLKN TNEHFRIARH EVMCTLEDTI RVAASLLKQG GKANFVHRPE       180
     RLLDIIDIMR KYRLEPKRIQ FVHPRSDREA NTVLVEGIKD GKPGVKYVPP VIVYDELGEY       240
     TPVIKEILYG ESE                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page