(data stored in ACNUC10821 zone)

EMBL: AE017262.PE179

AE017262.PE179       Location/Qualifiers
FT   CDS             174989..175870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0182"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /note="identified by similarity to GP:16412629; match to
FT                   protein family HMM PF00590; match to protein family HMM
FT                   TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02969"
FT                   /protein_id="AAT02969.1"
FT                   /translation="MIKSQKSFSGASQGALYLVPTPIGNLEDMTFRAIRMLKEADIIAA
FT                   EDTRNTVKLLNHFEITTRMTSYHQFTKENKEDNIIQRMLDGEVVALVSDAGMPSISDPG
FT                   YELVQSALNANIPVIPLPGANAALTALIASGLAPQPFYFYGFLPRQNKERTQAIEKLAA
FT                   REETWILYESPHRLKETLKAIIKITGNDRKIVLCRELTKRFEEFLRGTVEDALNWAMDE
FT                   EVRGEFCLIIEGNANPPLAEEQLWWQELDIKTHVSTVMEQENVSSKDAIKTVMKARNLP
FT                   KREVYSAYHEIK"
     MIKSQKSFSG ASQGALYLVP TPIGNLEDMT FRAIRMLKEA DIIAAEDTRN TVKLLNHFEI        60
     TTRMTSYHQF TKENKEDNII QRMLDGEVVA LVSDAGMPSI SDPGYELVQS ALNANIPVIP       120
     LPGANAALTA LIASGLAPQP FYFYGFLPRQ NKERTQAIEK LAAREETWIL YESPHRLKET       180
     LKAIIKITGN DRKIVLCREL TKRFEEFLRG TVEDALNWAM DEEVRGEFCL IIEGNANPPL       240
     AEEQLWWQEL DIKTHVSTVM EQENVSSKDA IKTVMKARNL PKREVYSAYH EIK              293
//

If you have problems or comments...

PBIL Back to PBIL home page