(data stored in ACNUC10821 zone)

EMBL: AE017262.PE180

AE017262.PE180       Location/Qualifiers
FT   CDS             complement(175915..176199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0183"
FT                   /product="transition state regulatory protein AbrB"
FT                   /note="identified by similarity to SP:P08874; match to
FT                   protein family HMM PF04014; match to protein family HMM
FT                   TIGR01439"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02970"
FT                   /protein_id="AAT02970.1"
FT                   /translation="MKSTGMVRKIDELGRVVIPIEIRRTMNLNVKDPLEIFTDEDAIVL
FT                   KKYSAGLVCDVTGEFSVDNKKFVDGKLTLSKEGAAELMEEIKRRFGDTL"
     MKSTGMVRKI DELGRVVIPI EIRRTMNLNV KDPLEIFTDE DAIVLKKYSA GLVCDVTGEF        60
     SVDNKKFVDG KLTLSKEGAA ELMEEIKRRF GDTL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page