(data stored in ACNUC10821 zone)

EMBL: AE017262.PE182

AE017262.PE182       Location/Qualifiers
FT   CDS             177238..178500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0211; match
FT                   to protein family HMM PF06742; match to protein family HMM
FT                   PF06863"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02972"
FT                   /protein_id="AAT02972.1"
FT                   /translation="MNANLEVNAEVVKESYVYLLSRYLVLRQENFDTKEDKIPYNTLKH
FT                   NSISPADANFVNPNFDVVYSEAWIAVDDENAVILEVPEIKNRYYTVQLLDGWGEVVTNI
FT                   NERNYPEHPHGKFAFVKKGTNPSVPSDAVKIELPSEKVKVLLRVEQKDDPEGAVKLQKA
FT                   FKFDAPDNIKIKEPLEIPHFTNAEFLLEEIYSNLEELLATYPDKMPRATEFQDKARQVA
FT                   AYIELGDEQKAEVRNLIVKEAIPYFTNGAKGFGTQKGGWSVTYVAGAFENDILARAIIN
FT                   YGGIWANSIQEALYFIGQKGTDNELLTGDKVYKIHFPADELPSELADAFWSVTLYSVPD
FT                   YHVIPNKLNKFRINNYSGPKLSEDGSLTLYIASEKPADVDPGNWLPSKAGKEFSLNFRL
FT                   YVPKKEVLEGKVFLPPLEVIK"
     MNANLEVNAE VVKESYVYLL SRYLVLRQEN FDTKEDKIPY NTLKHNSISP ADANFVNPNF        60
     DVVYSEAWIA VDDENAVILE VPEIKNRYYT VQLLDGWGEV VTNINERNYP EHPHGKFAFV       120
     KKGTNPSVPS DAVKIELPSE KVKVLLRVEQ KDDPEGAVKL QKAFKFDAPD NIKIKEPLEI       180
     PHFTNAEFLL EEIYSNLEEL LATYPDKMPR ATEFQDKARQ VAAYIELGDE QKAEVRNLIV       240
     KEAIPYFTNG AKGFGTQKGG WSVTYVAGAF ENDILARAII NYGGIWANSI QEALYFIGQK       300
     GTDNELLTGD KVYKIHFPAD ELPSELADAF WSVTLYSVPD YHVIPNKLNK FRINNYSGPK       360
     LSEDGSLTLY IASEKPADVD PGNWLPSKAG KEFSLNFRLY VPKKEVLEGK VFLPPLEVIK       420
//

If you have problems or comments...

PBIL Back to PBIL home page