(data stored in ACNUC10821 zone)

EMBL: AE017262.PE184

AE017262.PE184       Location/Qualifiers
FT   CDS             180191..181051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0187"
FT                   /product="glucose uptake protein"
FT                   /note="identified by similarity to GP:2226001; match to
FT                   protein family HMM PF06800"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02974"
FT                   /protein_id="AAT02974.1"
FT                   /translation="MNIMIALIPALLWGTVPLIITKFGGSTRQQTMGMTLGALTFAVIV
FT                   FFFTDPVYTLKTVGISFITGCLWTVGQMFQLQAFKIIGVSKAMPISTGMQLVGTTLCGV
FT                   ILFHEWDTTLRIILGFIALALIVGGIFLTSYAEKEEDGTNALKQGLITLFISACGYVGL
FT                   VVLIQGFKIDGINAILPQAVGMVLSALIMTHSGGTEKRFNKRTLLLTIPGIIWAAGNVA
FT                   MVHANQLVGVATGFSLSQLGVVISTIGGIVLLKEKKTQKEMFFVIVGVVLVVLGGILIG
FT                   VAKGA"
     MNIMIALIPA LLWGTVPLII TKFGGSTRQQ TMGMTLGALT FAVIVFFFTD PVYTLKTVGI        60
     SFITGCLWTV GQMFQLQAFK IIGVSKAMPI STGMQLVGTT LCGVILFHEW DTTLRIILGF       120
     IALALIVGGI FLTSYAEKEE DGTNALKQGL ITLFISACGY VGLVVLIQGF KIDGINAILP       180
     QAVGMVLSAL IMTHSGGTEK RFNKRTLLLT IPGIIWAAGN VAMVHANQLV GVATGFSLSQ       240
     LGVVISTIGG IVLLKEKKTQ KEMFFVIVGV VLVVLGGILI GVAKGA                      286
//

If you have problems or comments...

PBIL Back to PBIL home page