(data stored in ACNUC10821 zone)

EMBL: AE017262.PE187

AE017262.PE187       Location/Qualifiers
FT   CDS             184531..185409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0190"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02977"
FT                   /protein_id="AAT02977.1"
FT                   /translation="MVGMTRKKTLFWLCIFLLPNLLGFLIFIAIPILGSLGISFTDWDL
FT                   VSTIHFTGFENYKRLFNDPEFWKSFRNTITFIIGYLPSVMILGLACALMLNQKIKLRPF
FT                   FRAVYFLPVITSWVAVSLVWKWLFNPSYGLINYFLSLIGIAGPNWLTDPQTAMIAVIIT
FT                   SAWKDIGFVMVLFLGGLQNISPSYYEAANMDGASKLRQLFSITIPLLTPTTFFVTIISL
FT                   INSFQVFDQVMIMTEGGPSGATMTLVQNIYNHAFRYFEMGYASAMSWILFIVIFIITII
FT                   QNKLQKRWSNY"
     MVGMTRKKTL FWLCIFLLPN LLGFLIFIAI PILGSLGISF TDWDLVSTIH FTGFENYKRL        60
     FNDPEFWKSF RNTITFIIGY LPSVMILGLA CALMLNQKIK LRPFFRAVYF LPVITSWVAV       120
     SLVWKWLFNP SYGLINYFLS LIGIAGPNWL TDPQTAMIAV IITSAWKDIG FVMVLFLGGL       180
     QNISPSYYEA ANMDGASKLR QLFSITIPLL TPTTFFVTII SLINSFQVFD QVMIMTEGGP       240
     SGATMTLVQN IYNHAFRYFE MGYASAMSWI LFIVIFIITI IQNKLQKRWS NY               292
//

If you have problems or comments...

PBIL Back to PBIL home page