(data stored in ACNUC10821 zone)

EMBL: AE017262.PE188

AE017262.PE188       Location/Qualifiers
FT   CDS             185409..186257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0191"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02978"
FT                   /protein_id="AAT02978.1"
FT                   /translation="MKTEKSGSPKWQLFKNILTYTIICLGGIIMLMPFVWMVSTAFKTG
FT                   AANMVLPPQFIPKEPTTANFTQVFEMFPMLRFLVNSVVVAVVTTLGQMLFCSMAAYAFA
FT                   RIPFWGRDKLFLLYLATMMVPAQVTMIPQFILMKQFGWLDSYAGLIVPALFSVFGTFLL
FT                   RQAFMGIPKELEEAAFMDGANHFTIFRKVILPLAKPTFATLGILTFMQSWNSYLWPLIV
FT                   TSSQEMATLPLGLSLLQGRYGTNYGLMMAGVLISVIPILAVYLFAQKYFIQGMAMSGMK
FT                   E"
     MKTEKSGSPK WQLFKNILTY TIICLGGIIM LMPFVWMVST AFKTGAANMV LPPQFIPKEP        60
     TTANFTQVFE MFPMLRFLVN SVVVAVVTTL GQMLFCSMAA YAFARIPFWG RDKLFLLYLA       120
     TMMVPAQVTM IPQFILMKQF GWLDSYAGLI VPALFSVFGT FLLRQAFMGI PKELEEAAFM       180
     DGANHFTIFR KVILPLAKPT FATLGILTFM QSWNSYLWPL IVTSSQEMAT LPLGLSLLQG       240
     RYGTNYGLMM AGVLISVIPI LAVYLFAQKY FIQGMAMSGM KE                          282
//

If you have problems or comments...

PBIL Back to PBIL home page