(data stored in ACNUC10821 zone)

EMBL: AE017262.PE19

AE017262.PE19        Location/Qualifiers
FT   CDS             complement(22389..23507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4584121"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02809"
FT                   /protein_id="AAT02809.1"
FT                   /translation="MKSRKKGIILVLSIIIIFSIGLLVNNIMTNNKDTAKPKKKTVAAV
FT                   KKKKETPPKPKEPFNIDFTGDIMFDWDLRPVLAEKGMDYPFNNVREELKSSDYTFVDLE
FT                   TAITTRTKKVPYQEFWIKSDPSSLTALKNAGVDMVNISNNHILDYYEDGLLDTTAALRA
FT                   NNLAYVGAGKNEDEAYQLKVADIKGNKVGFMSFCHFFPNTGWIADEDTPGVTNGYDINL
FT                   VEEKIKEERAKNKDIDYMVVYFHWGVEKTNTPVDYQTQYVKKLVDDHLVDAIVASHPHW
FT                   LQSFEVYKDVPIAYSLGNFLFPDYVSGHSAETGIYKLNFNQGKVTAHFDPGIISGNQIN
FT                   MLDGSAKTAQLNYLQSISPNATINSNGDISAK"
     MKSRKKGIIL VLSIIIIFSI GLLVNNIMTN NKDTAKPKKK TVAAVKKKKE TPPKPKEPFN        60
     IDFTGDIMFD WDLRPVLAEK GMDYPFNNVR EELKSSDYTF VDLETAITTR TKKVPYQEFW       120
     IKSDPSSLTA LKNAGVDMVN ISNNHILDYY EDGLLDTTAA LRANNLAYVG AGKNEDEAYQ       180
     LKVADIKGNK VGFMSFCHFF PNTGWIADED TPGVTNGYDI NLVEEKIKEE RAKNKDIDYM       240
     VVYFHWGVEK TNTPVDYQTQ YVKKLVDDHL VDAIVASHPH WLQSFEVYKD VPIAYSLGNF       300
     LFPDYVSGHS AETGIYKLNF NQGKVTAHFD PGIISGNQIN MLDGSAKTAQ LNYLQSISPN       360
     ATINSNGDIS AK                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page