(data stored in ACNUC10821 zone)

EMBL: AE017262.PE194

AE017262.PE194       Location/Qualifiers
FT   CDS             196047..197273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P37546; match to
FT                   protein family HMM PF03990; match to protein family HMM
FT                   PF06725; match to protein family HMM PF07501"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02984"
FT                   /protein_id="AAT02984.1"
FT                   /translation="MTMENSSNVAQSSKWKLPIMIAGFVIVVALVFYFVFEGTKNDITI
FT                   VNAGEKIESRTHAKTVSEALDEAGIKVSERDEIAPGKNAEIKDGMEIKYLPARQITIND
FT                   NGTKKDVWSTKANVADLLKDENITTRPQDVLNVALDTKLKNGLEVNINRAIQLSLQNGA
FT                   KKDTVWTTKTKVSDLLAEKNIKLDQDDRVSPAKDSNLKEKMTVEVTYVNSKAEKKNEQV
FT                   KFETVYKEDDSLNKGVEKVVQEGKNGEKVVEYKVTFENGKEKKRDVIKENVTSKKTDKV
FT                   VVRGTKEKVVATPVSNVSTPSTTSSSSSSSSSTPSGGKTYRMESTAYSGGGTTAYGINL
FT                   SANPGLKVIAVDPRIIPLGSKVWVEGYGEAIAGDTGGAIKGNIVDVYFPNESQCYSWGR
FT                   RMVTVKVLN"
     MTMENSSNVA QSSKWKLPIM IAGFVIVVAL VFYFVFEGTK NDITIVNAGE KIESRTHAKT        60
     VSEALDEAGI KVSERDEIAP GKNAEIKDGM EIKYLPARQI TINDNGTKKD VWSTKANVAD       120
     LLKDENITTR PQDVLNVALD TKLKNGLEVN INRAIQLSLQ NGAKKDTVWT TKTKVSDLLA       180
     EKNIKLDQDD RVSPAKDSNL KEKMTVEVTY VNSKAEKKNE QVKFETVYKE DDSLNKGVEK       240
     VVQEGKNGEK VVEYKVTFEN GKEKKRDVIK ENVTSKKTDK VVVRGTKEKV VATPVSNVST       300
     PSTTSSSSSS SSSTPSGGKT YRMESTAYSG GGTTAYGINL SANPGLKVIA VDPRIIPLGS       360
     KVWVEGYGEA IAGDTGGAIK GNIVDVYFPN ESQCYSWGRR MVTVKVLN                    408
//

If you have problems or comments...

PBIL Back to PBIL home page