(data stored in ACNUC10821 zone)

EMBL: AE017262.PE195

AE017262.PE195       Location/Qualifiers
FT   CDS             197375..197950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0198"
FT                   /product="primase-related protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0224; match
FT                   to protein family HMM PF01751; match to protein family HMM
FT                   TIGR00334"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02985"
FT                   /protein_id="AAT02985.1"
FT                   /translation="MNGKPVIHEFIVVEGRDDTTAINRSVIADTIETNGSALSQETIEK
FT                   IRHAQELRGVIIFTDPDFPGEKIRKQIDSAVPGCKHAFINRQDALPKAGRGLGVEHASS
FT                   ANIREALENFHTSGTPAEKQFISKDILIHLGLLGGAGAKERREKIGNILKIGYTNGKQL
FT                   QTRLESFAISEDQLVAACQKIMQEEENE"
     MNGKPVIHEF IVVEGRDDTT AINRSVIADT IETNGSALSQ ETIEKIRHAQ ELRGVIIFTD        60
     PDFPGEKIRK QIDSAVPGCK HAFINRQDAL PKAGRGLGVE HASSANIREA LENFHTSGTP       120
     AEKQFISKDI LIHLGLLGGA GAKERREKIG NILKIGYTNG KQLQTRLESF AISEDQLVAA       180
     CQKIMQEEEN E                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page