(data stored in ACNUC10821 zone)

EMBL: AE017262.PE197

AE017262.PE197       Location/Qualifiers
FT   CDS             198950..199207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P37466; match to
FT                   protein family HMM PF06257"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02987"
FT                   /protein_id="AAT02987.1"
FT                   /translation="MPKTIASIKTNLDSRLGKALTLKANGGRKKTIERCGILAETYPSV
FT                   FIVELDQDENNFERVSYSYTDILTDAVELVFTDDNKELAL"
     MPKTIASIKT NLDSRLGKAL TLKANGGRKK TIERCGILAE TYPSVFIVEL DQDENNFERV        60
     SYSYTDILTD AVELVFTDDN KELAL                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page