(data stored in ACNUC10821 zone)

EMBL: AE017262.PE199

AE017262.PE199       Location/Qualifiers
FT   CDS             200249..200986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:VC1285; match to
FT                   protein family HMM PF04794"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02989"
FT                   /db_xref="GOA:Q724M2"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR022948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724M2"
FT                   /protein_id="AAT02989.1"
FT                   /translation="MKIIFNADDFGISPGAVYGILESYKRGVVKSTTLLANSPAFDLAV
FT                   EVAKENPGLDIGAHLTLTFGSPVLQGLETLTDDDGRFRRNYTSLENGLADVDMNEVERE
FT                   LTAQIEKILDAGITISHFDTHHSIEPLIYPVQHKLAEKYGVSIRRHSDVSDFGAIKTPD
FT                   LFATEFYADGVSFETIKKLVQKHIGTNDVVEVMTHPAFIDETLREISSYVEPRIKEVSI
FT                   LTSRELQAYLGQQEVEIISFRDL"
     MKIIFNADDF GISPGAVYGI LESYKRGVVK STTLLANSPA FDLAVEVAKE NPGLDIGAHL        60
     TLTFGSPVLQ GLETLTDDDG RFRRNYTSLE NGLADVDMNE VERELTAQIE KILDAGITIS       120
     HFDTHHSIEP LIYPVQHKLA EKYGVSIRRH SDVSDFGAIK TPDLFATEFY ADGVSFETIK       180
     KLVQKHIGTN DVVEVMTHPA FIDETLREIS SYVEPRIKEV SILTSRELQA YLGQQEVEII       240
     SFRDL                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page