(data stored in ACNUC10821 zone)

EMBL: AE017262.PE206

AE017262.PE206       Location/Qualifiers
FT   CDS             206573..207946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0209"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="identified by similarity to SP:P14192; match to
FT                   protein family HMM PF00132; match to protein family HMM
FT                   PF00483; match to protein family HMM TIGR01173"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02996"
FT                   /db_xref="GOA:Q724L5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724L5"
FT                   /protein_id="AAT02996.1"
FT                   /translation="MSKRYAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDQISTLN
FT                   VDKVVTIVGHGAEKVQEHLAGKSEFVKQEEQLGTAHAVLQAKAELAGKDGVTLVVCGDT
FT                   PLIEASTMEALLKYHHEKRAKATILTTVIEDPTGYGRIIRDDLGIVEKIVEHKDATEKE
FT                   QRISEINTGTYCFDNKALFEALENVSNDNVQGEYYLPDVIKILKDSDEVVAAYRMESFE
FT                   ESLGVNDRIALAEASRLMQRRINENHMRNGVTLVNPENTYIDIDVKIGQDTVIEPGVML
FT                   RGETVIGDDCVVTSGSEIVNSVIGERVHVRTSSIFESKVGDDVQIGPYAHLRPESDIHD
FT                   HVKIGNYVETKKAVVGEGTKLPHFIYMGDAEIGKNVNVGCGSIAVNYDGKNKAKTIIGD
FT                   NVFVGCNSNLIAPVKVGDRAFIAAGSTITKDVPDDALGIARAKQDNKLGYAKHLNHGK"
     MSKRYAVVLA AGQGTRMKSK LYKVLHPVCG KPMVEHVVDQ ISTLNVDKVV TIVGHGAEKV        60
     QEHLAGKSEF VKQEEQLGTA HAVLQAKAEL AGKDGVTLVV CGDTPLIEAS TMEALLKYHH       120
     EKRAKATILT TVIEDPTGYG RIIRDDLGIV EKIVEHKDAT EKEQRISEIN TGTYCFDNKA       180
     LFEALENVSN DNVQGEYYLP DVIKILKDSD EVVAAYRMES FEESLGVNDR IALAEASRLM       240
     QRRINENHMR NGVTLVNPEN TYIDIDVKIG QDTVIEPGVM LRGETVIGDD CVVTSGSEIV       300
     NSVIGERVHV RTSSIFESKV GDDVQIGPYA HLRPESDIHD HVKIGNYVET KKAVVGEGTK       360
     LPHFIYMGDA EIGKNVNVGC GSIAVNYDGK NKAKTIIGDN VFVGCNSNLI APVKVGDRAF       420
     IAAGSTITKD VPDDALGIAR AKQDNKLGYA KHLNHGK                                457
//

If you have problems or comments...

PBIL Back to PBIL home page