(data stored in ACNUC10821 zone)

EMBL: AE017262.PE21

AE017262.PE21        Location/Qualifiers
FT   CDS             complement(25213..26034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0018"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02811"
FT                   /protein_id="AAT02811.1"
FT                   /translation="MGNSFSKWGKWILVLGLMFSVFSVSTAGQAAAKETVINKQMVTTA
FT                   SLNVRSTNSTSGKVIGWLKSNTKFKAIAKTSNNWYRFSFKGKNGYVSGKYVKAATAAPA
FT                   PKPSTPKIVQMNVPLIVQRPQLPTGCEITNIAMMLRYAGKNVDKVKLAKEMKRHKSNPN
FT                   YGFVGNPFSKSGWTIYPPALVNQVKKYTGSAKNMTGTNLAGIKNQLNKKRPVVAWVSNF
FT                   HGFSVHAITITGYDKNNFYYNDSWSGQKNARISQSYFNTCWSKQAKRSISY"
     MGNSFSKWGK WILVLGLMFS VFSVSTAGQA AAKETVINKQ MVTTASLNVR STNSTSGKVI        60
     GWLKSNTKFK AIAKTSNNWY RFSFKGKNGY VSGKYVKAAT AAPAPKPSTP KIVQMNVPLI       120
     VQRPQLPTGC EITNIAMMLR YAGKNVDKVK LAKEMKRHKS NPNYGFVGNP FSKSGWTIYP       180
     PALVNQVKKY TGSAKNMTGT NLAGIKNQLN KKRPVVAWVS NFHGFSVHAI TITGYDKNNF       240
     YYNDSWSGQK NARISQSYFN TCWSKQAKRS ISY                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page