(data stored in ACNUC10821 zone)

EMBL: AE017262.PE216

AE017262.PE216       Location/Qualifiers
FT   CDS             complement(218592..218924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P33382; match to
FT                   protein family HMM PF01906"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03006"
FT                   /db_xref="GOA:Q724K5"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724K5"
FT                   /protein_id="AAT03006.1"
FT                   /translation="MIVTTSPNIEGKQIIEYKKIVFGEVITGVNFMKDIGAGLRNFFGG
FT                   RSQGYEDELINAREEAIREMEQRAKDIGANAVIGVDIDYEVLGADNGMLMVTASGTAVV
FT                   IEAQDY"
     MIVTTSPNIE GKQIIEYKKI VFGEVITGVN FMKDIGAGLR NFFGGRSQGY EDELINAREE        60
     AIREMEQRAK DIGANAVIGV DIDYEVLGAD NGMLMVTASG TAVVIEAQDY                  110
//

If you have problems or comments...

PBIL Back to PBIL home page