(data stored in ACNUC10821 zone)

EMBL: AE017262.PE217

AE017262.PE217       Location/Qualifiers
FT   CDS             complement(218991..219674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:18073204; match to
FT                   protein family HMM PF06352"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03007"
FT                   /protein_id="AAT03007.1"
FT                   /translation="MTRTITFDQLNTELQALENPNTIKIFRNHGCPDSLDLYGLKIGDL
FT                   KKIIRREKLTKNHELAVELIESNNSDLIYLGLLAINPDKITTEQIEKWNIIFRETWSQL
FT                   TFGLASIVSKRDDALLFAKTWIESDYDLTKSMGWQIYSEHINNLPEAEALLQRAKETLQ
FT                   TETNRTRYSMNGFIITCGIYKDDLHEKAMEAAKSVGKVHVNLGNTACKVPDAISYIEKA
FT                   RNRTK"
     MTRTITFDQL NTELQALENP NTIKIFRNHG CPDSLDLYGL KIGDLKKIIR REKLTKNHEL        60
     AVELIESNNS DLIYLGLLAI NPDKITTEQI EKWNIIFRET WSQLTFGLAS IVSKRDDALL       120
     FAKTWIESDY DLTKSMGWQI YSEHINNLPE AEALLQRAKE TLQTETNRTR YSMNGFIITC       180
     GIYKDDLHEK AMEAAKSVGK VHVNLGNTAC KVPDAISYIE KARNRTK                     227
//

If you have problems or comments...

PBIL Back to PBIL home page