(data stored in ACNUC10821 zone)

EMBL: AE017262.PE219

AE017262.PE219       Location/Qualifiers
FT   CDS             220978..221601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0222"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="identified by match to protein family HMM PF01386;
FT                   match to protein family HMM TIGR00731"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03009"
FT                   /db_xref="GOA:Q724K2"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724K2"
FT                   /protein_id="AAT03009.1"
FT                   /translation="MATTLEVQKRETTQHSEVTRLRSEGKVPGIIYGYKSENVPVSVDS
FT                   LELIKAVRDNGRNAVFSVTVDGKKLNVLLHEYQVDPLKDVLVHVDLLAVDMNEEVETDV
FT                   RVVLVGDAPGVKAGGVLQQIIHDVKVSATPEKLPETIELDISSLEIGDVLTTNDLPENK
FT                   DYVVQAEEEETVVTVSAPRAEEEPTTTEAPEPEAVHGKDEEPVE"
     MATTLEVQKR ETTQHSEVTR LRSEGKVPGI IYGYKSENVP VSVDSLELIK AVRDNGRNAV        60
     FSVTVDGKKL NVLLHEYQVD PLKDVLVHVD LLAVDMNEEV ETDVRVVLVG DAPGVKAGGV       120
     LQQIIHDVKV SATPEKLPET IELDISSLEI GDVLTTNDLP ENKDYVVQAE EEETVVTVSA       180
     PRAEEEPTTT EAPEPEAVHG KDEEPVE                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page