(data stored in ACNUC10821 zone)

EMBL: AE017262.PE22

AE017262.PE22        Location/Qualifiers
FT   CDS             26275..27015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0023"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02812"
FT                   /protein_id="AAT02812.1"
FT                   /translation="MAEPKYAIIINDIKRLISDGTFKPGEKIYSEDELKKKYNVSNTTV
FT                   VRALHELVRAGILARYQGKGTYVSKSIINEEVIFNEYTTVPNGRFNRKTKITNEHTKVV
FT                   AINEIQDARIAKKLQIPPENMIVHFQRIRLIDDVPWTVQNNYMAKSNLINVDLTNFERF
FT                   NSLSEVIKELYGINILHEAMKERIEVEFPVKDKNNFKLLEIDSELPLYHIERITYVPEG
FT                   QPYEYIESYLRHNFYSIEIEKKKQ"
     MAEPKYAIII NDIKRLISDG TFKPGEKIYS EDELKKKYNV SNTTVVRALH ELVRAGILAR        60
     YQGKGTYVSK SIINEEVIFN EYTTVPNGRF NRKTKITNEH TKVVAINEIQ DARIAKKLQI       120
     PPENMIVHFQ RIRLIDDVPW TVQNNYMAKS NLINVDLTNF ERFNSLSEVI KELYGINILH       180
     EAMKERIEVE FPVKDKNNFK LLEIDSELPL YHIERITYVP EGQPYEYIES YLRHNFYSIE       240
     IEKKKQ                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page