(data stored in ACNUC10821 zone)

EMBL: AE017262.PE223

AE017262.PE223       Location/Qualifiers
FT   CDS             226626..228215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0226"
FT                   /product="polysaccharide biosynthesis family protein"
FT                   /note="identified by match to protein family HMM PF01943"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03013"
FT                   /protein_id="AAT03013.1"
FT                   /translation="MPERSMKRLMKGAAWLTAASLISKILSAVYRVPFQNMVGDVGFYI
FT                   FQQVYPIYGIAMTLALGGFPVVISKMLAEAEGDVRRQQIIMRAVSRMLRIVSIVIFAFL
FT                   FLFANPIAIMMGDPALSELIRVISFVFLLMPQLAFMRGFFQGEGDMIPTAISQTVEQII
FT                   RVAIILIGAGLALHFNFDLYDAGSMAMSGAFFGGVSGIFILRHFYNKKVRLGEGIQPAV
FT                   FTNKEEKVGIGRTFLRQSVAICVVSSMLILFQLVDSFQVYRLMSDSGIPDFIAKSLKGV
FT                   YDRGQPILQLGLVISTGLALALVPMITAARVQDQQKELKRSVLLAIKITLILAGAETIG
FT                   LIVIMRPLNQMLFQTPDGTFVLQLFMPAVFLSSLIIMLSSILQGFGKITVPAVGVGIGL
FT                   IVKWVTGGILIPRLATVGASVSTCVGLLVILLICYVSLKQTIRVPFVEKTMLFRLIAAL
FT                   ALMAVFPCLFEWLAPLNTRLGSAFQAIVSALVGGGIFLVFSLRYKLLGPKDFVFLPFGS
FT                   KLLALSKLVARK"
     MPERSMKRLM KGAAWLTAAS LISKILSAVY RVPFQNMVGD VGFYIFQQVY PIYGIAMTLA        60
     LGGFPVVISK MLAEAEGDVR RQQIIMRAVS RMLRIVSIVI FAFLFLFANP IAIMMGDPAL       120
     SELIRVISFV FLLMPQLAFM RGFFQGEGDM IPTAISQTVE QIIRVAIILI GAGLALHFNF       180
     DLYDAGSMAM SGAFFGGVSG IFILRHFYNK KVRLGEGIQP AVFTNKEEKV GIGRTFLRQS       240
     VAICVVSSML ILFQLVDSFQ VYRLMSDSGI PDFIAKSLKG VYDRGQPILQ LGLVISTGLA       300
     LALVPMITAA RVQDQQKELK RSVLLAIKIT LILAGAETIG LIVIMRPLNQ MLFQTPDGTF       360
     VLQLFMPAVF LSSLIIMLSS ILQGFGKITV PAVGVGIGLI VKWVTGGILI PRLATVGASV       420
     STCVGLLVIL LICYVSLKQT IRVPFVEKTM LFRLIAALAL MAVFPCLFEW LAPLNTRLGS       480
     AFQAIVSALV GGGIFLVFSL RYKLLGPKDF VFLPFGSKLL ALSKLVARK                   529
//

If you have problems or comments...

PBIL Back to PBIL home page