(data stored in ACNUC10821 zone)

EMBL: AE017262.PE224

AE017262.PE224       Location/Qualifiers
FT   CDS             228239..228517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0227"
FT                   /product="S4 domain protein"
FT                   /note="identified by similarity to SP:P37557; match to
FT                   protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03014"
FT                   /protein_id="AAT03014.1"
FT                   /translation="MATTMRLDKYLKVSRLIKRRTVAKEVAEKGRIAVNGVTAKPGTNV
FT                   KSGDELVIRFGPKIVTAKIERLEENAKKEQATEMYTIIKEERTDESR"
     MATTMRLDKY LKVSRLIKRR TVAKEVAEKG RIAVNGVTAK PGTNVKSGDE LVIRFGPKIV        60
     TAKIERLEEN AKKEQATEMY TIIKEERTDE SR                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page