(data stored in ACNUC10821 zone)

EMBL: AE017262.PE225

AE017262.PE225       Location/Qualifiers
FT   CDS             228746..229132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0228"
FT                   /product="putative cell division protein DivIC"
FT                   /note="identified by similarity to SP:P37471; match to
FT                   protein family HMM PF04977"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03015"
FT                   /protein_id="AAT03015.1"
FT                   /translation="MKKAKSKVARIENRYIKDTATMKKTRSRRRIALFRRLAFMAIIFA
FT                   VVGGLLTITYTKQVLTLKEKKEKQVQVDKKMVAMKDEQDSLNEQIKKLHNDDYIAKLAR
FT                   SEYYLSKDGEIIFNIPEENSKQKE"
     MKKAKSKVAR IENRYIKDTA TMKKTRSRRR IALFRRLAFM AIIFAVVGGL LTITYTKQVL        60
     TLKEKKEKQV QVDKKMVAMK DEQDSLNEQI KKLHNDDYIA KLARSEYYLS KDGEIIFNIP       120
     EENSKQKE                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page