(data stored in ACNUC10821 zone)

EMBL: AE017262.PE229

AE017262.PE229       Location/Qualifiers
FT   CDS             234302..235081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0232"
FT                   /product="putative transcriptional activator, Baf family"
FT                   /note="identified by match to protein family HMM PF03309;
FT                   match to protein family HMM TIGR00671"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03019"
FT                   /db_xref="GOA:Q724J2"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724J2"
FT                   /protein_id="AAT03019.1"
FT                   /translation="MILVIDVGNTNCTVGVYEKQKLLKHWRMTTDRHRTSDELGMTVLN
FT                   FFSYANLTPSDIQGIIISSVVPPIMHAMETMCVRYFNIRPLIVGPGIKTGLNLKVDNPR
FT                   EIGSDRIVNAVAASEEYGTPVIVVDFGTATTFCYIDESGVYQGGAIAPGIMISTEALYN
FT                   RAAKLPRVDIAESNQIIGKSTVASMQAGIFYGFVGQCEGIIAEIKKQSNASPVVVATGG
FT                   LARMITEKSSAVDILDPFLTLKGLELLYRRNKPTTEK"
     MILVIDVGNT NCTVGVYEKQ KLLKHWRMTT DRHRTSDELG MTVLNFFSYA NLTPSDIQGI        60
     IISSVVPPIM HAMETMCVRY FNIRPLIVGP GIKTGLNLKV DNPREIGSDR IVNAVAASEE       120
     YGTPVIVVDF GTATTFCYID ESGVYQGGAI APGIMISTEA LYNRAAKLPR VDIAESNQII       180
     GKSTVASMQA GIFYGFVGQC EGIIAEIKKQ SNASPVVVAT GGLARMITEK SSAVDILDPF       240
     LTLKGLELLY RRNKPTTEK                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page