(data stored in ACNUC10821 zone)

EMBL: AE017262.PE230

AE017262.PE230       Location/Qualifiers
FT   CDS             235097..235981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0233"
FT                   /product="redox-regulated chaperone protein"
FT                   /note="identified by match to protein family HMM PF01430"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03020"
FT                   /db_xref="GOA:Q724J1"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724J1"
FT                   /protein_id="AAT03020.1"
FT                   /translation="MSDYLVKALAYDGMARVYAAVTTETIKEAQRRHDTWSVSSAALGR
FT                   TMTGTLFLGAMQKEDQKITVKIEGDGPIGPIVADSNAQGQIRGYVTNPHVHFSELNEAG
FT                   KLDVRRGVGTSGMLSVVKDLGFGENFTGQTPIVSGEIGEDFTYYLATSEQINSSVGVGV
FT                   LVNPDDTIEAAGGFMLQLLPGATDEIIDEIEKNLTALPTVSRMIEAGETPESILAKLAG
FT                   GEDKLQILEKIPVSFECNCSKERFGSAIISLGKEEIRSMIEEDHGAEAECHFCRNTYDF
FT                   SEEELEKLYEEAK"
     MSDYLVKALA YDGMARVYAA VTTETIKEAQ RRHDTWSVSS AALGRTMTGT LFLGAMQKED        60
     QKITVKIEGD GPIGPIVADS NAQGQIRGYV TNPHVHFSEL NEAGKLDVRR GVGTSGMLSV       120
     VKDLGFGENF TGQTPIVSGE IGEDFTYYLA TSEQINSSVG VGVLVNPDDT IEAAGGFMLQ       180
     LLPGATDEII DEIEKNLTAL PTVSRMIEAG ETPESILAKL AGGEDKLQIL EKIPVSFECN       240
     CSKERFGSAI ISLGKEEIRS MIEEDHGAEA ECHFCRNTYD FSEEELEKLY EEAK             294
//

If you have problems or comments...

PBIL Back to PBIL home page