(data stored in ACNUC10821 zone)

EMBL: AE017262.PE239

AE017262.PE239       Location/Qualifiers
FT   CDS             254287..254805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0242"
FT                   /product="UVR domain protein"
FT                   /note="identified by match to protein family HMM PF02151"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03029"
FT                   /protein_id="AAT03029.1"
FT                   /translation="MICQRCGENKAVIALQQLNELGKVKSLYLCENCATDEALSSEKDL
FT                   VKAMDTFSEVALDFLTLLQKEENAQKEIVCENCQLSFEEFLKTNRVGCPECYSAFEAQL
FT                   VPIIGRVQNGYKKHVGKVPAEVERAEGVQNEISRLQEKLAQLVENEEFEEAAVVRDEIK
FT                   ALKAGGEDK"
     MICQRCGENK AVIALQQLNE LGKVKSLYLC ENCATDEALS SEKDLVKAMD TFSEVALDFL        60
     TLLQKEENAQ KEIVCENCQL SFEEFLKTNR VGCPECYSAF EAQLVPIIGR VQNGYKKHVG       120
     KVPAEVERAE GVQNEISRLQ EKLAQLVENE EFEEAAVVRD EIKALKAGGE DK               172
//

If you have problems or comments...

PBIL Back to PBIL home page