(data stored in ACNUC10821 zone)

EMBL: AE017262.PE240

AE017262.PE240       Location/Qualifiers
FT   CDS             254802..255824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0243"
FT                   /product="ATP:guanido phosphotransferase family protein"
FT                   /note="identified by similarity to SP:P37570; match to
FT                   protein family HMM PF00217"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03030"
FT                   /db_xref="GOA:Q724I1"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724I1"
FT                   /protein_id="AAT03030.1"
FT                   /translation="MNVFEPRLSSWLENAGDDDDVVLSSRIRLARNLKDEQFPVYEQKE
FT                   EIVDNIAEVFDDNFTLIKMNQISLLQKALLVEKHLISPYMMNKSEYGAVLLNEEENVSI
FT                   MLNEEDHLRIQCMTPGLRLFDALEAALQIDGYVEEKLSYAFDKEFGYLTSCVTNIGTGM
FT                   RASVMVHLPGLVTTKRIKSVIEAIRSLGFVVRGIYGEGSMPASNIFQVSNQVTLGKTET
FT                   EIVEDLTQVMEQIIMQERVARTTIKQKFHIALEDRVFRSYGLLMNCRIISMKEASDAIS
FT                   DIRLGVELGFFEHISRQKMNELVLFSQPAFLRREAGRDMDELEEKVIRAKVIREILGDK
FT                   "
     MNVFEPRLSS WLENAGDDDD VVLSSRIRLA RNLKDEQFPV YEQKEEIVDN IAEVFDDNFT        60
     LIKMNQISLL QKALLVEKHL ISPYMMNKSE YGAVLLNEEE NVSIMLNEED HLRIQCMTPG       120
     LRLFDALEAA LQIDGYVEEK LSYAFDKEFG YLTSCVTNIG TGMRASVMVH LPGLVTTKRI       180
     KSVIEAIRSL GFVVRGIYGE GSMPASNIFQ VSNQVTLGKT ETEIVEDLTQ VMEQIIMQER       240
     VARTTIKQKF HIALEDRVFR SYGLLMNCRI ISMKEASDAI SDIRLGVELG FFEHISRQKM       300
     NELVLFSQPA FLRREAGRDM DELEEKVIRA KVIREILGDK                             340
//

If you have problems or comments...

PBIL Back to PBIL home page