(data stored in ACNUC10821 zone)

EMBL: AE017262.PE241

AE017262.PE241       Location/Qualifiers
FT   CDS             255853..258315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0244"
FT                   /product="ClpC ATPase"
FT                   /note="identified by similarity to GP:1314297; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF02151; match to protein family HMM PF02861; match to
FT                   protein family HMM PF07724"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03031"
FT                   /protein_id="AAT03031.1"
FT                   /translation="MMFGRFTQRAQKVLALSQEEAMRLNHSNLGTEHILLGLVREGEGI
FT                   AAKALYELGISSEKVQQEVEGLIGHGEKAVTTIQYTPRAKKVIELSMDEARKLGHTYVG
FT                   TEHILLGLIREGEGVAARVLSNLGISLNKARQQVLQLLGGGDATGAGRQTNTQATPTLD
FT                   SLARDLTVIAREDNLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQ
FT                   QIVRNEVPETLRGKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNVILFIDELH
FT                   TLIGAGGAEGAIDASNILKPPLARGELQCIGATTLDEYRKYIEKDAALERRFQPIKVDE
FT                   PTVEESIQILHGLRDRYEAHHRVAITDEALEAAVRLSDRYISDRFLPDKAIDVIDESGS
FT                   KVRLKSFTTPKNVKEMENNLSDLKKEKDAAVQGQEFEKAASLRDKEQKLKKSLEETKAN
FT                   WQEKQGLDHSEVTEEIVAEVVASWTGIPVAKLAETETNKLLNMEKLLHERVIGQDAAVK
FT                   AVSLAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDEDSMIRIDMSEY
FT                   MEKFSTARLVGAPPGYVGYEEGGQLTEKVRQKPYSVVLLDEIEKAHPDVFNMLLQVLDD
FT                   GRLTDSKGRVVDFRNTVIIMTSNIGAQEMKQDKSMGFNVIDPLKDHKAMEHRVLQDLKQ
FT                   AFRPEFINRIDETIVFHSLQEKELKQIVTLLTAQLTKRLAERDIHVKLTEGAKSKIAKD
FT                   GYDPEYGARPLKRAIQKEVEDMLSEELLRGNIKVGDYVEIGVKDGKLEVRKKDAPKKKT
FT                   TAKKVKTK"
     MMFGRFTQRA QKVLALSQEE AMRLNHSNLG TEHILLGLVR EGEGIAAKAL YELGISSEKV        60
     QQEVEGLIGH GEKAVTTIQY TPRAKKVIEL SMDEARKLGH TYVGTEHILL GLIREGEGVA       120
     ARVLSNLGIS LNKARQQVLQ LLGGGDATGA GRQTNTQATP TLDSLARDLT VIAREDNLDP       180
     VIGRSKEIQR VIEVLSRRTK NNPVLIGEPG VGKTAIAEGL AQQIVRNEVP ETLRGKRVMT       240
     LDMGTVVAGT KYRGEFEDRL KKVMDEIRQA GNVILFIDEL HTLIGAGGAE GAIDASNILK       300
     PPLARGELQC IGATTLDEYR KYIEKDAALE RRFQPIKVDE PTVEESIQIL HGLRDRYEAH       360
     HRVAITDEAL EAAVRLSDRY ISDRFLPDKA IDVIDESGSK VRLKSFTTPK NVKEMENNLS       420
     DLKKEKDAAV QGQEFEKAAS LRDKEQKLKK SLEETKANWQ EKQGLDHSEV TEEIVAEVVA       480
     SWTGIPVAKL AETETNKLLN MEKLLHERVI GQDAAVKAVS LAVRRARAGL KDPKRPIGSF       540
     IFLGPTGVGK TELARALAES MFGDEDSMIR IDMSEYMEKF STARLVGAPP GYVGYEEGGQ       600
     LTEKVRQKPY SVVLLDEIEK AHPDVFNMLL QVLDDGRLTD SKGRVVDFRN TVIIMTSNIG       660
     AQEMKQDKSM GFNVIDPLKD HKAMEHRVLQ DLKQAFRPEF INRIDETIVF HSLQEKELKQ       720
     IVTLLTAQLT KRLAERDIHV KLTEGAKSKI AKDGYDPEYG ARPLKRAIQK EVEDMLSEEL       780
     LRGNIKVGDY VEIGVKDGKL EVRKKDAPKK KTTAKKVKTK                             820
//

If you have problems or comments...

PBIL Back to PBIL home page