(data stored in ACNUC10821 zone)

EMBL: AE017262.PE25

AE017262.PE25        Location/Qualifiers
FT   CDS             27943..28746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0026"
FT                   /product="putative PTS system, mannose-specific, IIC
FT                   component"
FT                   /note="identified by similarity to SP:P08187; match to
FT                   protein family HMM PF03609"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02815"
FT                   /protein_id="AAT02815.1"
FT                   /translation="MDLAVWQIILLVILAACTILDALTLVIGLNFPVITGTLAGIIMGD
FT                   MVLGLAIGATLQLMVLGVGTYGGASIPDFTTGAIVGTVFAVLSGQDAEFAIGLAIPVGL
FT                   LMVQLDILARFTNTFFLHRIDSNIASGNISAVKRNIWYGALPWALSRAVPVFIMLTFGQ
FT                   SVVDFILNEIPEWLMGGLRVAGGILPVVGIAILLRYLPTNKFVAYLIIGFVAAAYLKVP
FT                   MLGVALIGVALAIIYFKQNFKNPVAAGANGAALVGEENEDGEYED"
     MDLAVWQIIL LVILAACTIL DALTLVIGLN FPVITGTLAG IIMGDMVLGL AIGATLQLMV        60
     LGVGTYGGAS IPDFTTGAIV GTVFAVLSGQ DAEFAIGLAI PVGLLMVQLD ILARFTNTFF       120
     LHRIDSNIAS GNISAVKRNI WYGALPWALS RAVPVFIMLT FGQSVVDFIL NEIPEWLMGG       180
     LRVAGGILPV VGIAILLRYL PTNKFVAYLI IGFVAAAYLK VPMLGVALIG VALAIIYFKQ       240
     NFKNPVAAGA NGAALVGEEN EDGEYED                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page