(data stored in ACNUC10821 zone)

EMBL: AE017262.PE251

AE017262.PE251       Location/Qualifiers
FT   CDS             267325..267837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05991"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03041"
FT                   /protein_id="AAT03041.1"
FT                   /translation="MEQILLVDGYNVIGAWPELSFLKDRDLEAARDKLVEWMAEYQSYT
FT                   GYRVVVVFDAQFVRGVKRKSKKYQVEVVFTHEDETADEYIEQKAIEWKNVRTQIMVATS
FT                   DYTEQWAIFGQGALRISSRELLFEIQEMSKQIGQKIKRIQEEMPKSNLNLDSDVISQLE
FT                   KWRRGEE"
     MEQILLVDGY NVIGAWPELS FLKDRDLEAA RDKLVEWMAE YQSYTGYRVV VVFDAQFVRG        60
     VKRKSKKYQV EVVFTHEDET ADEYIEQKAI EWKNVRTQIM VATSDYTEQW AIFGQGALRI       120
     SSRELLFEIQ EMSKQIGQKI KRIQEEMPKS NLNLDSDVIS QLEKWRRGEE                  170
//

If you have problems or comments...

PBIL Back to PBIL home page