(data stored in ACNUC10821 zone)

EMBL: AE017262.PE26

AE017262.PE26        Location/Qualifiers
FT   CDS             28727..29548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0027"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /note="identified by similarity to SP:P08188; match to
FT                   protein family HMM PF03613"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02816"
FT                   /protein_id="AAT02816.1"
FT                   /translation="MANTKTEQDFEKVLKRRDLIAANFRWLFASQICWNYERMMSTGYL
FT                   YSILPTLRKLYKTDDDLKDMMNMHNQFFNTNPMVGGLILGMDMAIEEREKKASKEVVTG
FT                   LKTGLMGPFAGVGDTIFGVILPTIFGSIAAYMGLQGNVTGVVIWVLVNILVVGARFTLL
FT                   PLGYKQGAKLVTEFADRLNALTDAAILLGVTVVGALIPTVIKATVPFVYKSGKVELKMQ
FT                   DMLDQIMPSLVPVLLVALIYALLGHKKMTSTKAILLVMVIAIILFNLKILG"
     MANTKTEQDF EKVLKRRDLI AANFRWLFAS QICWNYERMM STGYLYSILP TLRKLYKTDD        60
     DLKDMMNMHN QFFNTNPMVG GLILGMDMAI EEREKKASKE VVTGLKTGLM GPFAGVGDTI       120
     FGVILPTIFG SIAAYMGLQG NVTGVVIWVL VNILVVGARF TLLPLGYKQG AKLVTEFADR       180
     LNALTDAAIL LGVTVVGALI PTVIKATVPF VYKSGKVELK MQDMLDQIMP SLVPVLLVAL       240
     IYALLGHKKM TSTKAILLVM VIAIILFNLK ILG                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page