(data stored in ACNUC10821 zone)

EMBL: AE017262.PE262

AE017262.PE262       Location/Qualifiers
FT   CDS             273728..274906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:4678913; match to
FT                   protein family HMM PF01139"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03052"
FT                   /protein_id="AAT03052.1"
FT                   /translation="MLTLKGKYNEAKVFTDNVDDNTIGQIITLCNQPFAKGSKIRIMPD
FT                   THGGKGCVIGTTMTIQDKIVPNLVGVDIGCGLYVVKLKPGKLKMDFDKLDKVIRERVPS
FT                   GSKTHDKPVDEFDLEGIVAPIHRGWVARSIGTLGGGNHFIEVNQGSDGIYLVIHSGSRV
FT                   LGKEIAEYHQEVAYKRLDILRKELKLDATAAKKRGNLEMANNLNGEREQVKLDYDLSYV
FT                   TGSDLNNYLNDMEIAQKFAARNRYVMAETILKAMKWDKIVVSAFDCVHNYIDIDNHMLR
FT                   KGATSAQLGEQIIVPLNMRDGSILATGKGNADWNYSAPHGAGRMLSRSKAKAQISLESY
FT                   QAAMKDVWTTSVSKKTIDEAPKAYKSAKQLLVDVEDTMEIQEIIKPLYNFKA"
     MLTLKGKYNE AKVFTDNVDD NTIGQIITLC NQPFAKGSKI RIMPDTHGGK GCVIGTTMTI        60
     QDKIVPNLVG VDIGCGLYVV KLKPGKLKMD FDKLDKVIRE RVPSGSKTHD KPVDEFDLEG       120
     IVAPIHRGWV ARSIGTLGGG NHFIEVNQGS DGIYLVIHSG SRVLGKEIAE YHQEVAYKRL       180
     DILRKELKLD ATAAKKRGNL EMANNLNGER EQVKLDYDLS YVTGSDLNNY LNDMEIAQKF       240
     AARNRYVMAE TILKAMKWDK IVVSAFDCVH NYIDIDNHML RKGATSAQLG EQIIVPLNMR       300
     DGSILATGKG NADWNYSAPH GAGRMLSRSK AKAQISLESY QAAMKDVWTT SVSKKTIDEA       360
     PKAYKSAKQL LVDVEDTMEI QEIIKPLYNF KA                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page