(data stored in ACNUC10821 zone)

EMBL: AE017262.PE263

AE017262.PE263       Location/Qualifiers
FT   CDS             275051..276046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0266"
FT                   /product="transcriptional regulator, DegA family"
FT                   /note="identified by similarity to SP:P37947; match to
FT                   protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03053"
FT                   /protein_id="AAT03053.1"
FT                   /translation="MNKVTKIGDVAEKTGYSITTISRAINGNPNVSDKTKKKIFAAMKE
FT                   LNYYPNNIAQQFRGQGTKMIGVVISFITNPFFAYLVDAIERYLSHRGYQVVMLQTLENP
FT                   AKELQFIEMLQKKQLDGLIMANLENDTEEIKSLVESGKIVLCNRYLGNENLTIINIDET
FT                   KAAYQATNYLIKCGYKRLAYCTGGIKNKNDYRFKGFMQAVTENGLSFDESLYFEKLLTI
FT                   KDGEELLVNILEEKSTLPDAIFSNGDTVAAGILYAAKKYGIAVPEELGIIGFDNQPIAE
FT                   VLNPALTTIEQPIKELGEYSAQVLLANLQGTSVPVAPELETKLIIRETTK"
     MNKVTKIGDV AEKTGYSITT ISRAINGNPN VSDKTKKKIF AAMKELNYYP NNIAQQFRGQ        60
     GTKMIGVVIS FITNPFFAYL VDAIERYLSH RGYQVVMLQT LENPAKELQF IEMLQKKQLD       120
     GLIMANLEND TEEIKSLVES GKIVLCNRYL GNENLTIINI DETKAAYQAT NYLIKCGYKR       180
     LAYCTGGIKN KNDYRFKGFM QAVTENGLSF DESLYFEKLL TIKDGEELLV NILEEKSTLP       240
     DAIFSNGDTV AAGILYAAKK YGIAVPEELG IIGFDNQPIA EVLNPALTTI EQPIKELGEY       300
     SAQVLLANLQ GTSVPVAPEL ETKLIIRETT K                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page