(data stored in ACNUC10821 zone)

EMBL: AE017262.PE27

AE017262.PE27        Location/Qualifiers
FT   CDS             29576..30280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:8894743; match to
FT                   protein family HMM PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02817"
FT                   /protein_id="AAT02817.1"
FT                   /translation="MGLTFFDKARELTEELEKTQAESIHQAAKLVADSIMNDGIIQAFG
FT                   SGHSYAAAIEVCGRAGGLIPSKVIMDPAGGYYESIEGVGSLLTHRLQAKPNDIFFLISN
FT                   SGRNPMGIELAEWIKSQGCKLIVVTALDASQTAASRHSSGKLLYEFADVILDNRSVQGD
FT                   AALELDGLEGKVCGTSSFSAVLLLQQTIYEAVELMLEKGYTPPVYRSANIDGGYEYNFA
FT                   IEDKFADRIFHF"
     MGLTFFDKAR ELTEELEKTQ AESIHQAAKL VADSIMNDGI IQAFGSGHSY AAAIEVCGRA        60
     GGLIPSKVIM DPAGGYYESI EGVGSLLTHR LQAKPNDIFF LISNSGRNPM GIELAEWIKS       120
     QGCKLIVVTA LDASQTAASR HSSGKLLYEF ADVILDNRSV QGDAALELDG LEGKVCGTSS       180
     FSAVLLLQQT IYEAVELMLE KGYTPPVYRS ANIDGGYEYN FAIEDKFADR IFHF             234
//

If you have problems or comments...

PBIL Back to PBIL home page