(data stored in ACNUC10821 zone)

EMBL: AE017262.PE273

AE017262.PE273       Location/Qualifiers
FT   CDS             290739..291260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03063"
FT                   /protein_id="AAT03063.1"
FT                   /translation="MGETLNTVPNTRYDHHPLDTYPEVVLRKNAKETLEKVKQLGFKQA
FT                   ILSNTATSDTEVIKRVLTNFGIIDYFDFIYASNSELQPGKMEKPDKTIFDFTLNALQID
FT                   KTEAVMVGNTFESDIIGANRAGIHAIWLQNPEVCLQDERLPLVAPPFVIPVWDLADVPE
FT                   ALLLLKKISA"
     MGETLNTVPN TRYDHHPLDT YPEVVLRKNA KETLEKVKQL GFKQAILSNT ATSDTEVIKR        60
     VLTNFGIIDY FDFIYASNSE LQPGKMEKPD KTIFDFTLNA LQIDKTEAVM VGNTFESDII       120
     GANRAGIHAI WLQNPEVCLQ DERLPLVAPP FVIPVWDLAD VPEALLLLKK ISA              173
//

If you have problems or comments...

PBIL Back to PBIL home page