(data stored in ACNUC10821 zone)

EMBL: AE017262.PE274

AE017262.PE274       Location/Qualifiers
FT   CDS             291326..292786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0277"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03064"
FT                   /protein_id="AAT03064.1"
FT                   /translation="MTEVKKQFPKGFLWGGATAANQVEGAYDVDGKGLSTADMVKFIPK
FT                   EERTQDHALDVSKAEIEAIIAGKVEGRFPKRDGVDFYHHYKEDIALFAEMGFKTFRLSL
FT                   NWARIFPNGDDKEPNEKGLEFYDKVFDELLKYDIEPLVTLSHYETPLNLTLKYNGWADR
FT                   RVIGFFTNYAETVFKRYKNKVKYWLTFNEINVISLSAYTGGGVLLEDAKNPLELSYQAG
FT                   HHQFVASALATKLAHEIIPGSQVGCMLARMATYPATNNPDDILKAQYENQQNLFFTDVH
FT                   ARGEYPSFMNRFFQENDIHIVKEVGDDEILKAHTVDFISFSYYMSLSATASPEGDRSAG
FT                   NLMGGVKNEYLESSDWGWQIDPKGLRWTLNDLYSRYELPLFIVENGLGAYDTVEEDGKI
FT                   HDDYRIDYLRKHIEQMKEAIADGVDLIGYTSWGPIDLVSASTSEMSKRYGFIYVDQDDW
FT                   GKGTLERSRKDSFFWYKKVIETNGEDLV"
     MTEVKKQFPK GFLWGGATAA NQVEGAYDVD GKGLSTADMV KFIPKEERTQ DHALDVSKAE        60
     IEAIIAGKVE GRFPKRDGVD FYHHYKEDIA LFAEMGFKTF RLSLNWARIF PNGDDKEPNE       120
     KGLEFYDKVF DELLKYDIEP LVTLSHYETP LNLTLKYNGW ADRRVIGFFT NYAETVFKRY       180
     KNKVKYWLTF NEINVISLSA YTGGGVLLED AKNPLELSYQ AGHHQFVASA LATKLAHEII       240
     PGSQVGCMLA RMATYPATNN PDDILKAQYE NQQNLFFTDV HARGEYPSFM NRFFQENDIH       300
     IVKEVGDDEI LKAHTVDFIS FSYYMSLSAT ASPEGDRSAG NLMGGVKNEY LESSDWGWQI       360
     DPKGLRWTLN DLYSRYELPL FIVENGLGAY DTVEEDGKIH DDYRIDYLRK HIEQMKEAIA       420
     DGVDLIGYTS WGPIDLVSAS TSEMSKRYGF IYVDQDDWGK GTLERSRKDS FFWYKKVIET       480
     NGEDLV                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page