(data stored in ACNUC10821 zone)

EMBL: AE017262.PE275

AE017262.PE275       Location/Qualifiers
FT   CDS             293001..293444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0278"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03065"
FT                   /protein_id="AAT03065.1"
FT                   /translation="MKKTRVTWAIVIAIAGLLVSVISLSVNITQNRYNVRGVDSSSQWK
FT                   TGFQKNQTVCAIETKKHWTKGSVKYGVNQTSGTVKTKYSIYSKKNNDRYVLMYKDGYTS
FT                   RNNTYYGEFYGHYAGGKDKFSYKLEKKNNKNVKSQLIVDLFVI"
     MKKTRVTWAI VIAIAGLLVS VISLSVNITQ NRYNVRGVDS SSQWKTGFQK NQTVCAIETK        60
     KHWTKGSVKY GVNQTSGTVK TKYSIYSKKN NDRYVLMYKD GYTSRNNTYY GEFYGHYAGG       120
     KDKFSYKLEK KNNKNVKSQL IVDLFVI                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page