(data stored in ACNUC10821 zone)

EMBL: AE017262.PE28

AE017262.PE28        Location/Qualifiers
FT   CDS             30335..30976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0029"
FT                   /product="cutC family protein"
FT                   /note="identified by match to protein family HMM PF03932"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02818"
FT                   /protein_id="AAT02818.1"
FT                   /translation="MILKEACIENTTNLVNVIEAGANRVELCDNLAEGGTSVSYGIAKH
FT                   VVKICHEQNVSVMAMVRPRKGNFVYTKEEISVMIDDILMYKKIAVDGVVFGCITDSGLL
FT                   DKPAIIELLKATAGLEVTFHMAFDELVDSEKLPAIDWLAEQDVTRILTHGGDGAKLPEE
FT                   TFLQWRKYIDYAAGRIIILPGGGIKSHNMEWITKETGAAEIHGTDLFGER"
     MILKEACIEN TTNLVNVIEA GANRVELCDN LAEGGTSVSY GIAKHVVKIC HEQNVSVMAM        60
     VRPRKGNFVY TKEEISVMID DILMYKKIAV DGVVFGCITD SGLLDKPAII ELLKATAGLE       120
     VTFHMAFDEL VDSEKLPAID WLAEQDVTRI LTHGGDGAKL PEETFLQWRK YIDYAAGRII       180
     ILPGGGIKSH NMEWITKETG AAEIHGTDLF GER                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page