(data stored in ACNUC10821 zone)

EMBL: AE017262.PE282

AE017262.PE282       Location/Qualifiers
FT   CDS             304412..304828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0285"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03072"
FT                   /protein_id="AAT03072.1"
FT                   /translation="MVKKEERLGVLLWFRFSRFYNRNMKLTNQNLRAVGISTAQFDCIA
FT                   QIGLDKEITQQQLAEKLVVTKGNVTQLLAKLEQLGYITRTKTGREKHITLTEKGQACYR
FT                   ENVPKQEAFQQAQFDKLTRDEQKELLKLLKKLGE"
     MVKKEERLGV LLWFRFSRFY NRNMKLTNQN LRAVGISTAQ FDCIAQIGLD KEITQQQLAE        60
     KLVVTKGNVT QLLAKLEQLG YITRTKTGRE KHITLTEKGQ ACYRENVPKQ EAFQQAQFDK       120
     LTRDEQKELL KLLKKLGE                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page