(data stored in ACNUC10821 zone)

EMBL: AE017262.PE283

AE017262.PE283       Location/Qualifiers
FT   CDS             304835..305794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0286"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03073"
FT                   /protein_id="AAT03073.1"
FT                   /translation="MKLTGIHHVSIFTANARANFDFYTKIMGLRLVKKSVNQDDPYTYH
FT                   LYYGDEIGSPGTALTFFEVPNMAKNHPSRNAISSLSLRVPSDEALHYWDKRLDEHRIFH
FT                   SKPIDQFGRKIIRLKDTDGLPVNLISDETSTQVTEVSPWEDSPVPAEYAIRGLGPVRFS
FT                   VFKKEKTDRLLTKILGFERIGAYEDDDKLVTVFKTGDVGLGGEVHVESRPDLEQGNLGA
FT                   GGIHHVAFRVPTDGDLIGWTEMIQDLGYKNSGYVDRFYFHSLYFRESNGILIELATDEP
FT                   GFQTDFTKEHGTYVDLPPHLENRREDILAHLKPLDTDK"
     MKLTGIHHVS IFTANARANF DFYTKIMGLR LVKKSVNQDD PYTYHLYYGD EIGSPGTALT        60
     FFEVPNMAKN HPSRNAISSL SLRVPSDEAL HYWDKRLDEH RIFHSKPIDQ FGRKIIRLKD       120
     TDGLPVNLIS DETSTQVTEV SPWEDSPVPA EYAIRGLGPV RFSVFKKEKT DRLLTKILGF       180
     ERIGAYEDDD KLVTVFKTGD VGLGGEVHVE SRPDLEQGNL GAGGIHHVAF RVPTDGDLIG       240
     WTEMIQDLGY KNSGYVDRFY FHSLYFRESN GILIELATDE PGFQTDFTKE HGTYVDLPPH       300
     LENRREDILA HLKPLDTDK                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page