(data stored in ACNUC10821 zone)

EMBL: AE017262.PE284

AE017262.PE284       Location/Qualifiers
FT   CDS             305866..306501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0287"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03074"
FT                   /protein_id="AAT03074.1"
FT                   /translation="MAEGLRTIYFVRHGKTEWNMTGQMQGWGDSPLVAEGIDGAKAVGE
FT                   VLKDTPIDAVYTSTSKRTQDTAAYILGDREIEIQPLEELKEMGFGTWEGIRVTEIDEQH
FT                   PEERAKILHSPETYKAEVNGGETYYELAERLLEGVEKIIAENLSGNILVVSHGMSLTLL
FT                   LYLLQGGTVEDHRKEAPRILNTSISIVEYQNGEFSLKKINEIGHLDLK"
     MAEGLRTIYF VRHGKTEWNM TGQMQGWGDS PLVAEGIDGA KAVGEVLKDT PIDAVYTSTS        60
     KRTQDTAAYI LGDREIEIQP LEELKEMGFG TWEGIRVTEI DEQHPEERAK ILHSPETYKA       120
     EVNGGETYYE LAERLLEGVE KIIAENLSGN ILVVSHGMSL TLLLYLLQGG TVEDHRKEAP       180
     RILNTSISIV EYQNGEFSLK KINEIGHLDL K                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page