(data stored in ACNUC10821 zone)

EMBL: AE017262.PE285

AE017262.PE285       Location/Qualifiers
FT   CDS             306585..308471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0288"
FT                   /product="putative transporter"
FT                   /note="identified by similarity to SP:P37315; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03075"
FT                   /protein_id="AAT03075.1"
FT                   /translation="MKRIVKIFLHYLLGILGIILISCVPAIFSKVTSWSSSTYWEALKS
FT                   IFTAIFHPTKWEISYQGSAEVFHVSLADFITGPYFYSMKIIVASLLISAIIAYLLVIAT
FT                   FRGPKWLRQGLSGFLSILQAFPDFSFIFLIQMAVVYIYQQTGVFTLNFYSLNGEQIYAA
FT                   PIVCLSIIPTVLFYKMMMLLMENEWQADYIQLARGKGLTDRAILLRHATPNMMQSLFYQ
FT                   SKTIVWFILSAYLIVEFLFGIEGVLYYLLAGFSPLNIFLVLALVFTPFYFFYALIDLWI
FT                   SRGKNTESANVTRIPLHWNSFQKTFTEKVNLKSKWRNFVVTTGQLLKRPSFSIPLATLS
FT                   ILLIASLIYGLMGDKINSLKFISDATGRVTDMAPFKPNAQVWLGTDQAGNSILDQLLVG
FT                   IKYTLLIAVIIATLRVVIGYILAVPLAFFSKPRTRNFVQSIADGMHYLPLSLLVFIIMV
FT                   NEFISYSGVFETSLFTRITFQILIMVVIVLPITTNRISSEISQVLKKEFVLSALVFGGN
FT                   ARWILTKHINPQIWSKLILIWIEQLIQTLQMFVHLAIFGIFIGGAIMGADDGMLNPVIP
FT                   ELSGLIANAKFVFANHQFWIILPPLVVFMILILCFQMMANSLLKREEESKKA"
     MKRIVKIFLH YLLGILGIIL ISCVPAIFSK VTSWSSSTYW EALKSIFTAI FHPTKWEISY        60
     QGSAEVFHVS LADFITGPYF YSMKIIVASL LISAIIAYLL VIATFRGPKW LRQGLSGFLS       120
     ILQAFPDFSF IFLIQMAVVY IYQQTGVFTL NFYSLNGEQI YAAPIVCLSI IPTVLFYKMM       180
     MLLMENEWQA DYIQLARGKG LTDRAILLRH ATPNMMQSLF YQSKTIVWFI LSAYLIVEFL       240
     FGIEGVLYYL LAGFSPLNIF LVLALVFTPF YFFYALIDLW ISRGKNTESA NVTRIPLHWN       300
     SFQKTFTEKV NLKSKWRNFV VTTGQLLKRP SFSIPLATLS ILLIASLIYG LMGDKINSLK       360
     FISDATGRVT DMAPFKPNAQ VWLGTDQAGN SILDQLLVGI KYTLLIAVII ATLRVVIGYI       420
     LAVPLAFFSK PRTRNFVQSI ADGMHYLPLS LLVFIIMVNE FISYSGVFET SLFTRITFQI       480
     LIMVVIVLPI TTNRISSEIS QVLKKEFVLS ALVFGGNARW ILTKHINPQI WSKLILIWIE       540
     QLIQTLQMFV HLAIFGIFIG GAIMGADDGM LNPVIPELSG LIANAKFVFA NHQFWIILPP       600
     LVVFMILILC FQMMANSLLK REEESKKA                                          628
//

If you have problems or comments...

PBIL Back to PBIL home page