(data stored in ACNUC10821 zone)

EMBL: AE017262.PE293

AE017262.PE293       Location/Qualifiers
FT   CDS             complement(315169..315990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0296"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="identified by similarity to GP:16412731; match to
FT                   protein family HMM TIGR00099; match to protein family HMM
FT                   TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03083"
FT                   /protein_id="AAT03083.1"
FT                   /translation="MTKKYLICSDIDGTLLRQDQTVSKKTRDLIQTLEKDGHIFSISTG
FT                   RMYRSAREVGFQVSNSGHVIASNGSYAAIRDEQLLKTTLEEKAIRSTYDIMSDFDLPLF
FT                   FFSTNTLFYTKEPPAFFQNLADKSRLDTGHNSFSLVSINEKGVFDENMHQFLNAIVVAE
FT                   DDASKLTEVRAALNEANGIRVLSSHHNNLEILPANSDKKTAVEALGKHYNIPRERIITF
FT                   GDGENDIGMLQYAGTGVAMANASDNVKAAADHLTDTNEADGVYKFLKEFIS"
     MTKKYLICSD IDGTLLRQDQ TVSKKTRDLI QTLEKDGHIF SISTGRMYRS AREVGFQVSN        60
     SGHVIASNGS YAAIRDEQLL KTTLEEKAIR STYDIMSDFD LPLFFFSTNT LFYTKEPPAF       120
     FQNLADKSRL DTGHNSFSLV SINEKGVFDE NMHQFLNAIV VAEDDASKLT EVRAALNEAN       180
     GIRVLSSHHN NLEILPANSD KKTAVEALGK HYNIPRERII TFGDGENDIG MLQYAGTGVA       240
     MANASDNVKA AADHLTDTNE ADGVYKFLKE FIS                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page