(data stored in ACNUC10821 zone)

EMBL: AE017262.PE295

AE017262.PE295       Location/Qualifiers
FT   CDS             complement(317115..318215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0298"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to SP:Q00752; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03085"
FT                   /protein_id="AAT03085.1"
FT                   /translation="MAQLSLEHIYKIYDNKVTAVSDFNLEIDDKEFIVFVGPSGCGKST
FT                   TLRMIAGLEEISKGELSIDGKVMNNVAPKDRDIAMVFQNYALYPHMTVYDNMAFGLKLR
FT                   KMPKDEIKKRVEHAANILGLTEYLKRKPSALSGGQRQRVALGRAIVRDAKVFLMDEPLS
FT                   NLDAKLRVQMRAEITKLHQQLDTTMIYVTHDQTEAMTMATRIVIMKDGVIQQVGSPKQV
FT                   YDHPVNMFVAGFIGSPAMNFFKGRLEGSNFIGDDFTIEVPEGKLKLLKDRGFDGKDIVF
FT                   GIRPEDIHDEPIVIEANPGYTFKATTIVAELTGAEFMLHSRVGTHEFVARVDARSEHQP
FT                   NEVLTLAFEMSKSHFFDPETEDNLTD"
     MAQLSLEHIY KIYDNKVTAV SDFNLEIDDK EFIVFVGPSG CGKSTTLRMI AGLEEISKGE        60
     LSIDGKVMNN VAPKDRDIAM VFQNYALYPH MTVYDNMAFG LKLRKMPKDE IKKRVEHAAN       120
     ILGLTEYLKR KPSALSGGQR QRVALGRAIV RDAKVFLMDE PLSNLDAKLR VQMRAEITKL       180
     HQQLDTTMIY VTHDQTEAMT MATRIVIMKD GVIQQVGSPK QVYDHPVNMF VAGFIGSPAM       240
     NFFKGRLEGS NFIGDDFTIE VPEGKLKLLK DRGFDGKDIV FGIRPEDIHD EPIVIEANPG       300
     YTFKATTIVA ELTGAEFMLH SRVGTHEFVA RVDARSEHQP NEVLTLAFEM SKSHFFDPET       360
     EDNLTD                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page