(data stored in ACNUC10821 zone)

EMBL: AE017262.PE30

AE017262.PE30        Location/Qualifiers
FT   CDS             33167..34042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0027; match
FT                   to protein family HMM PF02016"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02820"
FT                   /protein_id="AAT02820.1"
FT                   /translation="MLAKGDLIGIICCSDGRKKEDEKDLKRLKQVLEKEFGLQVVFAKT
FT                   IFQIDDSPFNGTPEERAAELMKLYQNMDVKMIFDISGGDAANQVLPYLNFNIIKKAAKP
FT                   FIGYSDLTVILNAIFAKTKQPGFNYLLRNLVGEASEIQRVQFQKTFFENQIAINGKSLN
FT                   EFEWSLGEIVGGNIRCFLKLAGTEFMPDVSNKIILLESLGGKEAKIASYVAQLEQLGVF
FT                   SKCLGIVVGEHTEAEKNGEYDRIGILYQQIGLKYKLPVFRTKEIGHSSEAKPCLIGTKV
FT                   NVSRETLTNF"
     MLAKGDLIGI ICCSDGRKKE DEKDLKRLKQ VLEKEFGLQV VFAKTIFQID DSPFNGTPEE        60
     RAAELMKLYQ NMDVKMIFDI SGGDAANQVL PYLNFNIIKK AAKPFIGYSD LTVILNAIFA       120
     KTKQPGFNYL LRNLVGEASE IQRVQFQKTF FENQIAINGK SLNEFEWSLG EIVGGNIRCF       180
     LKLAGTEFMP DVSNKIILLE SLGGKEAKIA SYVAQLEQLG VFSKCLGIVV GEHTEAEKNG       240
     EYDRIGILYQ QIGLKYKLPV FRTKEIGHSS EAKPCLIGTK VNVSRETLTN F                291
//

If you have problems or comments...

PBIL Back to PBIL home page