(data stored in ACNUC10821 zone)

EMBL: AE017262.PE303

AE017262.PE303       Location/Qualifiers
FT   CDS             325941..327122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0306"
FT                   /product="aminotransferase, class I"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03093"
FT                   /protein_id="AAT03093.1"
FT                   /translation="MKISKRLQNLPDQFFSSLVEKVGKKVAEGHDVINLGQGNPDQPTP
FT                   KHIVEAMKTASEKPLNHKYSLFRGKHELKQAAADFYAREYNVTIDPNTEVAILFGTKTG
FT                   LVELPMCLMDPGDTMLLPDPGYPDYLSGVVLGEVQFEKMPLIAANNFLPDFTKIPEDIA
FT                   EKAELMYLNYPNNPTGAVATADFFEETVAFAKNHNIVVAHDFAYGGIGFDGKKPISFLE
FT                   TNGAKEVGIELYTLSKTYNMAGWRVGFAVGNSEVIEAINLIQDHMYVSLFPGIQDAAIE
FT                   ALTGDQTCVGELTARYESRRDAFISACKKIGWEAVAPAGSFFAWMPVPENFTSSEFADY
FT                   LLEEVSVAVADGSGFGEFGEGYVRVGLLMDEERLEEAVTRVSKLHLFDKVTQQ"
     MKISKRLQNL PDQFFSSLVE KVGKKVAEGH DVINLGQGNP DQPTPKHIVE AMKTASEKPL        60
     NHKYSLFRGK HELKQAAADF YAREYNVTID PNTEVAILFG TKTGLVELPM CLMDPGDTML       120
     LPDPGYPDYL SGVVLGEVQF EKMPLIAANN FLPDFTKIPE DIAEKAELMY LNYPNNPTGA       180
     VATADFFEET VAFAKNHNIV VAHDFAYGGI GFDGKKPISF LETNGAKEVG IELYTLSKTY       240
     NMAGWRVGFA VGNSEVIEAI NLIQDHMYVS LFPGIQDAAI EALTGDQTCV GELTARYESR       300
     RDAFISACKK IGWEAVAPAG SFFAWMPVPE NFTSSEFADY LLEEVSVAVA DGSGFGEFGE       360
     GYVRVGLLMD EERLEEAVTR VSKLHLFDKV TQQ                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page