(data stored in ACNUC10821 zone)

EMBL: AE017262.PE305

AE017262.PE305       Location/Qualifiers
FT   CDS             328233..330065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0308"
FT                   /product="sensory box histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF00989; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03095"
FT                   /protein_id="AAT03095.1"
FT                   /translation="MHKMRFFQSVQFKLVIMYLLLIIVAMQVIGAYFVRELEGQLEKNF
FT                   QDSITNSITLLDYNAREEIIKNSDNSVKLQNDIRELLVDYSRASSNLIEVRIVDDKGKI
FT                   LGTSNLNNQGIVGQKSNDPLVKRTLSLGTTSEDKIYKDESNKNNRVWVNVSSIKNKGQV
FT                   IGAIYLVADIESVYKQVDDITNIFITGTLIAMIITAVLGILLSRTITKPIIEMKRQAYA
FT                   MARGNYSRKVKVYGVDEIGELADSFNTLTKRVQEAQAMTEGERRKLSSVLAYMTDGVIA
FT                   TDRRGKVILINTPAEKMLRVKHESANGRSIIDVLDIGDTYQFEDLMEVDGSLTMDRSTL
FT                   DKPYVLRANFSVIQRETGFNNGVIAVLHDITDQEKVDQERRDFVSNVSHELRTPLTSMH
FT                   SYLEALSDGAWEDKEIAPRFLEVTQNETERMIRLVNDLLKLSRMDGGREQLEKSFVNFT
FT                   DFFNHIIDRFEMMKKETIMFKRHIPREPVIIEIDEDKVMQVLDNIISNANKYSPDGGRI
FT                   SFYLKKFEDEIEVSIADEGLGVPDEDLANVFDRFFRVDKARSREMGGTGLGLAIAREVI
FT                   EAHGGRIWAERNKTKGTIIKFTLPYSDLPEDDWE"
     MHKMRFFQSV QFKLVIMYLL LIIVAMQVIG AYFVRELEGQ LEKNFQDSIT NSITLLDYNA        60
     REEIIKNSDN SVKLQNDIRE LLVDYSRASS NLIEVRIVDD KGKILGTSNL NNQGIVGQKS       120
     NDPLVKRTLS LGTTSEDKIY KDESNKNNRV WVNVSSIKNK GQVIGAIYLV ADIESVYKQV       180
     DDITNIFITG TLIAMIITAV LGILLSRTIT KPIIEMKRQA YAMARGNYSR KVKVYGVDEI       240
     GELADSFNTL TKRVQEAQAM TEGERRKLSS VLAYMTDGVI ATDRRGKVIL INTPAEKMLR       300
     VKHESANGRS IIDVLDIGDT YQFEDLMEVD GSLTMDRSTL DKPYVLRANF SVIQRETGFN       360
     NGVIAVLHDI TDQEKVDQER RDFVSNVSHE LRTPLTSMHS YLEALSDGAW EDKEIAPRFL       420
     EVTQNETERM IRLVNDLLKL SRMDGGREQL EKSFVNFTDF FNHIIDRFEM MKKETIMFKR       480
     HIPREPVIIE IDEDKVMQVL DNIISNANKY SPDGGRISFY LKKFEDEIEV SIADEGLGVP       540
     DEDLANVFDR FFRVDKARSR EMGGTGLGLA IAREVIEAHG GRIWAERNKT KGTIIKFTLP       600
     YSDLPEDDWE                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page